PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014415
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 231aa    MW: 26695.8 Da    PI: 5.381
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014415genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.5e-151360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEde+l  +v+ +G + W++Iar  g++R++k+c+ rw++yl
      Lus10014415 13 KGPWLEEEDERLGSLVNAFGEKKWDSIARISGLRRSGKSCRMRWLNYL 60
                     79********************************************97 PP

2Myb_DNA-binding56.18.7e-1866111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r r T++E+++++++++q+G++ W++Iar ++ gRt++++k++w+++l
      Lus10014415  66 RCRITADEEQIIIQLHHQWGNK-WSRIARSLP-GRTDNEIKNYWRTHL 111
                      5688******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.72860IPR017930Myb domain
SuperFamilySSF466891.64E-2711107IPR009057Homeodomain-like
SMARTSM007172.4E-121262IPR001005SANT/Myb domain
PfamPF002495.3E-131360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-201467IPR009057Homeodomain-like
CDDcd001671.47E-81560No hitNo description
PROSITE profilePS5129425.99361115IPR017930Myb domain
SMARTSM007177.2E-1665113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2468116IPR009057Homeodomain-like
PfamPF002492.1E-1568111IPR001005SANT/Myb domain
CDDcd001679.60E-1270111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MAIEQPGDST LRKGPWLEEE DERLGSLVNA FGEKKWDSIA RISGLRRSGK SCRMRWLNYL  60
RPNLKRCRIT ADEEQIIIQL HHQWGNKWSR IARSLPGRTD NEIKNYWRTH LSKKMIIQDQ  120
EQEGEFHHDT SNHVNDNVAQ QDLVALVQDG FGVGSDEQYD SWKLMDSPYE LRLYEHWLSE  180
INKSGDQEEC KGCVNGGLEE CFGCNYRCMG LCNYAVGDQN SVVDCLWEHS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-27111152105C-Myb DNA-Binding Domain
1mse_C2e-27111152105C-Myb DNA-Binding Domain
1gv2_A2e-27111152105MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-27811553159MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-27811553159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002265893.21e-59PREDICTED: myb-related protein 305
TrEMBLA0A067JZ697e-59A0A067JZ69_JATCU; Uncharacterized protein
TrEMBLA0A097HUK12e-62A0A097HUK1_JATCU; MYB family protein
STRINGPOPTR_0006s12400.13e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.18e-56myb domain protein 27